SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002115 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002115
Domain Number 1 Region: 60-257
Classification Level Classification E-value
Superfamily L domain-like 8.17e-31
Family Ngr ectodomain-like 0.0057
Further Details:      
 
Domain Number 2 Region: 254-345
Classification Level Classification E-value
Superfamily Immunoglobulin 1.78e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 440-513
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000394
Family Fibronectin type III 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002115   Gene: ENSMODG00000001729   Transcript: ENSMODT00000002158
Sequence length 635
Comment pep:novel chromosome:BROADO5:1:65463877:65473902:-1 gene:ENSMODG00000001729 transcript:ENSMODT00000002158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVAMGVLWCLVLRSLPQALGSCPSQCSCSLHSLSDGTKNRAVVCNDPEMTLPPMMIPSD
TSKLRIEKTSIRRVPGDALHHLTRLEYLWLPYNSMTSISSVMLRGLRRLQELRLPGNYLV
SFPWGALGDTPQLRLLDLHANRLSAVSAEAARYARNLTFLDLSSNQLMRLPQQLLTTWSH
LQAGPYSPGENSKIILGLQDNPWMCDCSLYDMVQILNFPTPNMAFIDPRLKCSTPWSLAG
VAFSQLELRKCQRPEVYTSVAKVKTLLGSTVFLRCGATGVPSPELSWRRADGHQLNGTVH
QESSNDGMSWSLLGLPDVSHHDSGEYVCKAKNSLGATEAFVSLIITESQTTAEPPGSTTR
LWPGKSEGAEAAAYNELVARYASTTSRPSSLVARPTLPSYEKNPALQHFHMNALGELSVG
SPGAEQADRAKDLPLNHLEPTQMVRSVKVVGDTYHSVTLVWKAPQAGNTTMFSVLYAIFG
EKDMKRVSVDPGKTKVTIEGLMPKTKYVACVCVRGLVPKKEQCIIFSTDEVVDAEGTQRL
INVVVITIAGIIAVPLTLLVCCGSLKRRYQKFRLRKNEETQSSYVTFERLSPGEDGVEDS
AKDSPEEGDRLLSSRSSMDSHAPSKVEGQANEYFC
Download sequence
Identical sequences F6XG68
13616.ENSMODP00000002115 ENSMODP00000002115 ENSMODP00000002115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]