SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002573 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002573
Domain Number 1 Region: 64-397
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 7.59e-17
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 2 Region: 3-41
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000107
Family I set domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002573   Gene: ENSMODG00000002116   Transcript: ENSMODT00000002627
Sequence length 459
Comment pep:novel chromosome:BROADO5:5:112880178:113029108:1 gene:ENSMODG00000002116 transcript:ENSMODT00000002627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSANGSEVHISNVRYEDTGAYTCIAKNEAGVDEDISSLFVEDSARKTLANILWREEGLGI
GNMFYVFYEDGIKVIQPIECEFQRHIKPSEKLLGFQASDEVCPQAEGDTVQRCVWASAVN
VKDKFIYVTQPTLDRVLIVDVQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLSWGNMEKTS
PTLQVITQASSSVSHHTIHTQPVGKQFDRVDDFFIPSTTLIITHMRFGFILHKDEAILQK
IDLETLSYIKTVSLKDYNCIPQSLAYTHLGGYYFISCSPDSTGAIPPQLMVDSVTDSVIG
YNGDVMGTPYVSPDGHYLVSIDDVKGLMRVQYITIRGEIQDAFDIHTNLHISDVTFQPSF
TEAHQYNVYGSSGMQTDVLFVELASGKVKMIKSLKEPLKAEEWPWNQKNRLIKDSGLFGQ
YLMTPSKQSLFILDGRLNKLNCEITEVEKGNTVIWVGDA
Download sequence
Identical sequences F6UG69
13616.ENSMODP00000002573 ENSMODP00000002573 ENSMODP00000002573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]