SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002578 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002578
Domain Number 1 Region: 79-132
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000114
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 2 Region: 258-323
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000056
Family I set domains 0.091
Further Details:      
 
Domain Number 3 Region: 178-246
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000593
Family Calmodulin-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002578   Gene: ENSMODG00000002119   Transcript: ENSMODT00000002632
Sequence length 354
Comment pep:novel chromosome:BROADO5:5:112060407:112826701:1 gene:ENSMODG00000002119 transcript:ENSMODT00000002632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKCWSAVLFLGFIFLRAEGRPTKEGGYGLKSYQPLVRLRHKEKSQESSRSKGYLSQDGP
LVSCENKYCGLGRHCVISRETGQAECACMDHCKPHYKPVCGSDGEFYENHCEVHRAACLK
KQKITIVHNEDCFFKGDKCKATEFSKMKNRFLDLQNQKYVTQENENPPEDEIVRKKLLVD
QMFKYFDSDSNGLVDSNELSQVIKQDELGKDLSDCSLFDLLKYDDFNSDKHLALEEFYRA
FQVIQLSLPEDQKVSITAATVGQSAVLTCAIQGALRPPIIWKRNHVVLNNLDLEDINDFG
DDGSLYITKVTTTHMGNYTCYADGYDKLYQTHIFQVNGKKPSVVVIIFLNSLDF
Download sequence
Identical sequences F6UG38
ENSMODP00000002578 ENSMODP00000002578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]