SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002580 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002580
Domain Number 1 Region: 25-124
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000314
Family V set domains (antibody variable domain-like) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002580   Gene: ENSMODG00000002120   Transcript: ENSMODT00000002634
Sequence length 419
Comment pep:novel chromosome:BROADO5:2:113380406:113401053:-1 gene:ENSMODG00000002120 transcript:ENSMODT00000002634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDILFWIIFFLPISKALKSLEKINLSGYLGGSIVIRCPLKNLRQRTYLCREAISKSCQTV
VSNKGFVEKNFEDRVSLKLLPEENVFLVELRKLKEGDQGNYACGVGDKTDRGKTQKVTLK
VTKDYYPFWEYPEFTEYLPPPWEWIPNEASSSLSTTQASSTSAPKSHPWQVQTQPPPPIH
PSPTSPVLLLRNTLAAAAPSQTFSSSEASKTPRLGRLLRAPTDSYPHHTRLQSESASYFG
SSLKKDGGFHILILATLGMFLMMLLGLVLGRTLQKRRALSKRINRLTLRMSALEASSRAY
SHLYHSHQRSLHRPVSNRPRSQQNIYSACPRQVQGPNQNGENISGREPGVLEHSTTTQVS
KMAQLQAPVPVNNEYGSTYYLGLAEPEEDDSHDYINVSCLTQLPCSPPVLGFHANQDCC
Download sequence
Identical sequences F6U118
XP_007481354.1.35504 ENSMODP00000002580 ENSMODP00000002580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]