SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002649 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002649
Domain Number 1 Region: 234-409
Classification Level Classification E-value
Superfamily Kelch motif 2.48e-29
Family Kelch motif 0.016
Further Details:      
 
Domain Number 2 Region: 62-252
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-27
Family Kelch motif 0.0079
Further Details:      
 
Domain Number 3 Region: 410-459,700-845
Classification Level Classification E-value
Superfamily Fibronectin type III 3.55e-24
Family Fibronectin type III 0.00000597
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002649   Gene: ENSMODG00000002178   Transcript: ENSMODT00000002703
Sequence length 854
Comment pep:novel chromosome:BROADO5:8:83818149:83848735:1 gene:ENSMODG00000002178 transcript:ENSMODT00000002703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHRGRDQRLLPSIAPPTAPVGPAPPGEVRRWGGGGGDRGAVHCGAAEGAGVSKMAAPSL
LNWRRVSSFTGQVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTVTNQWFLPAVRG
DIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPRPPATGLPPCP
RLGHSFSLYGNKCYLFGGLANESEDSNSNVPRYLNDFYELELQHGSGVVGWSIPVTKGIM
PSPRESHTAVIYCRKDSGNPKMYIFGGMCGSRLDDLWQLDLETMSWSQPETKGSVPLPRS
LHTANVIGNKMYIFGGWVPQTMNSIEASSRDCEWRCTSSFSYLNLDTAEWTSLVSDSQED
KKNLRPRPRAGHCAVAIGTRLYFWSGRDGYKKAMNNQVCCKDLWYLDTEKPPAPSQVQVI
KATTNSFQVKWDEVPTVEGYLLQLNTDLPYLTASPDSHTNLPGIQASFPRQASNNTVPNN
MPVSLLSQELLKLEDTGNSTESDHIIMKGTAVKSQSDLKEMESNTSSLPSFALATNVADG
SCSAKVLKKNEGAQTSMNVSESYGLDLRTVNPETAAASAISGVRAMVPHRVIKTESSSTN
GAVIKDETSLTAFSAKSEADEAFMQPTTKVSSAETQDSAIPLSKDTPSKPTTLEKRGERQ
WCDVGIFKNNTALVNQFYLLPKGKQNISKVGNTDVPDYSLLKKQDLVPGTVYRFRIAAIN
GCGIGPFSKISEFKTCIPGFPGAPCAVRISKNVDCIHLSWEPPASPSGNILEYSAYLAIR
TAQVPDNPSQPMFMRIYCGLKTSCVVTAGQLANAHVDYTSRPAIVFRISAKNEKGYGPAT
QVRWLQERKESSSK
Download sequence
Identical sequences F7GEG5
ENSMODP00000002649 ENSMODP00000002649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]