SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002693 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002693
Domain Number 1 Region: 134-196
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.89e-16
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 2 Region: 75-137
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 22-88
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000526
Family Complement control module/SCR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002693   Gene: ENSMODG00000002211   Transcript: ENSMODT00000002748
Sequence length 250
Comment pep:novel chromosome:BROADO5:2:113697519:113710638:1 gene:ENSMODG00000002211 transcript:ENSMODT00000002748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSWLISCILVTEWLLPTSGEDCPSPPPVNNSILVGTCMEGNVLGTYICIKGYHLVGKKE
LLYNNTSLEWDSPAPICHLGHCPIPVLVNGHMNSSNLEPVSEGEVVTFECDTDYILKGSN
WSQCQKNNMWIPPLPICSTGQCPPPRKPKLGHFKARDFNSGSNVTFYCNDGYQLIGAQSL
QCMDGEWSHEPPICEKMEVKKEASCVFQENNICETVQRWIQYQKASGQTLEELKYSLEIK
KLQLEKIKFS
Download sequence
Identical sequences F7G3E0
ENSMODP00000002693 XP_001372805.1.35504 13616.ENSMODP00000002693 ENSMODP00000002693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]