SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002718 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002718
Domain Number 1 Region: 112-184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.17e-17
Family Complement control module/SCR domain 0.00045
Further Details:      
 
Domain Number 2 Region: 173-236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000904
Family Complement control module/SCR domain 0.0004
Further Details:      
 
Domain Number 3 Region: 235-300
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000105
Family Complement control module/SCR domain 0.00057
Further Details:      
 
Domain Number 4 Region: 425-488
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000472
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 482-539
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000122
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 6 Region: 51-116
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000747
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 7 Region: 299-371
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000773
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002718
Domain Number - Region: 361-418
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00264
Family Complement control module/SCR domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002718   Gene: ENSMODG00000002230   Transcript: ENSMODT00000002773
Sequence length 637
Comment pep:novel chromosome:BROADO5:2:113719432:113764366:1 gene:ENSMODG00000002230 transcript:ENSMODT00000002773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKIWKKHLVTAFPRVTKEMAHRREKWKVHGSTLFQIILSFALLGMVNGTCGFPPTLHFA
SPESVLDQSIFPEGTQLKYNCRPGYTRSSSRNVLTCRDKSWHFLNPFCIKKRCEHPGELN
NGRVIIKTDLDFGSKIEFSCLDGYHLIGSSTSICGISDSRLTWSEPLPVCEIVTCPPPSP
ISNGKHNGREDNIYTFGSSVTYRCNTPFSLIGEASISCSVVNETIGTWNPPPPNCKIVVC
NQPQISNGNMVSGLRSTYTYKDTILFECKKGYLLHGSSLIHCGADNNWIPALPNCVLNSC
LSPPHIENAELSSPHLGYEGEFPVGTLLTFACRYGYKAVPDRPITAVCQEDFKWQVDEGV
CKRICCPSPHIDHGKFLGFTDECIHFPRNSFTIPCKRKSKRSICQGDGTWKPAISSCEDK
EDEVCNSPKAIPNGDYKKTSSLFSSEVTVNYSCNDGYVMIGNAEITCKYSRWSHPFPRCG
AICPKPEIPNGKLSPENTRYISTQTVNVQCSHGYNLVGPQNITCSDDRSWTPEVPKCEWE
FPEGCEKVSAGYRLMQCLPNAQDVKMALEIYKIALEIEMLKLELDKKEGTYQKPSLSPAP
APSPSPPSSPSPSPPSSPSPSPSPSISSPFGMDSEYY
Download sequence
Identical sequences F7DFU6
XP_007481362.1.35504 XP_007481363.1.35504 XP_007481364.1.35504 ENSMODP00000002718 ENSMODP00000002718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]