SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002798 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002798
Domain Number 1 Region: 59-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000804
Family I set domains 0.0058
Further Details:      
 
Domain Number 2 Region: 156-245
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000155
Family I set domains 0.069
Further Details:      
 
Domain Number 3 Region: 254-359
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000664
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002798   Gene: ENSMODG00000002293   Transcript: ENSMODT00000002854
Sequence length 414
Comment pep:novel chromosome:BROADO5:7:65591021:65632868:1 gene:ENSMODG00000002293 transcript:ENSMODT00000002854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNHRPLDTGPQISVSCFQKRYGLFFFLYALVVNVSASSIQLQESTENCQDFGDNFIRFV
VEGEPVVLKAPFLRDFFSLPYKLSWHKNDSEKTVLGVGESGRTWIKDNALWIVPASVEDT
GTYICTIRNESYCATKSIELKVLKKMTASLHLISYRQTVVSSSPGRLVCPEINDFIQKTN
KMEIKWYKDSVLLDESNKKFSILKGSTDCHINNVSLNNSGYYTCELPFVHGNVKYNITRH
IKLRVLKKKEDSFPVIILPNKTISTSLGSKLIIPCKAFFGLGPQSTMLLWWTANKTFVDN
VYKEGRVKEGQHHKYLENNKSYLEAPLIFDSVEKKDLYTEFVCTARNRLGSQTLHARVKE
EPPFSWGIAVAPLSLILLVFVGIWIHRRWKQRSGKAYTPGKSKIISHECQPYTP
Download sequence
Identical sequences F7CBZ9
ENSMODP00000002798 ENSMODP00000002798 XP_007501220.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]