SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002833 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002833
Domain Number 1 Region: 28-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000207
Family V set domains (antibody variable domain-like) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002833   Gene: ENSMODG00000002325   Transcript: ENSMODT00000002889
Sequence length 319
Comment pep:novel chromosome:BROADO5:1:69017777:69144422:-1 gene:ENSMODG00000002325 transcript:ENSMODT00000002889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLLALALAFLAARAPVPDICEALNVTVSPGPVVQYLEGENATLFCHVSQKRRKDNLLAI
RWLFALSPLQETPMIKMTKLRMVQYYGNYSRSFNRQRLRLLEERHGRLYSLSVLNLQPED
QGRYICKVQEIGKHKSKWTAWSNGTAATEIRVISPKASDDPTFEKKKETWAFFEDLYMYA
VLVCCIGILSVLLFTLIILCQSLINKRKSRVKHYLVKCPQNSSGETVTSVTSLSPLQPKK
AKKRKEKPDVPPAVPAKAPIANAFHKPKLLKPQRKVILPRITEENLTYAELELIKPHQAS
KGLPTSTVYAQILFEENKL
Download sequence
Identical sequences F6YCQ1
ENSMODP00000002833 13616.ENSMODP00000002833 XP_007478665.1.35504 ENSMODP00000002833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]