SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002834 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002834
Domain Number 1 Region: 52-223
Classification Level Classification E-value
Superfamily Fibronectin type III 3.91e-20
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 2 Region: 224-396
Classification Level Classification E-value
Superfamily Fibronectin type III 9.85e-20
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 3 Region: 395-565
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000017
Family Fibronectin type III 0.005
Further Details:      
 
Domain Number 4 Region: 564-640
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000033
Family Fibronectin type III 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002834
Domain Number - Region: 654-726
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00226
Family Fibronectin type III 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002834   Gene: ENSMODG00000002324   Transcript: ENSMODT00000002890
Sequence length 749
Comment pep:novel chromosome:BROADO5:2:477678659:477705296:1 gene:ENSMODG00000002324 transcript:ENSMODT00000002890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGPSIFALFNGVTLLGTVASLRPNTVHTIKVDAFDKNGMLLAEALTMQLTAPEIPIIDR
AYSKLSNSITVEWTPVPGATSYLLTAQDGESFIETIVTNSPGTVSGLKAATMYKITIRSV
NAGGRSQASLPKKAKTVLAAPILDVSSPSSDSILVQWEAVSMAVGFSVSIMRSNGLGRMW
KENTTNTSLTFTSLDAGTLYTIKAYAWNANGIPGDDSTYNQRTSPHAPADIQVSFDSGTQ
KATVSWMPTEGAFSYTVTASSGASKLNCSTASTSCTISALQCGTEYTLSILASNDAGSSH
STATVSLKTVACAPRSILIQEDNPGHLSVSWSDAELGDYYVAFVKSDDGLEMHCNTSLTQ
CNFPAECGFTYFISVFAYNEAGQSPLGDVFNYTTAPCCPGDINPVFVSSDTAQLVWSPVR
GAEMYETKAVDGNHVIECNDTATACTLSALQCDTVYNVTVYSFSEIKGSNTSCAPQCVTT
APCSPEIKNVSKDTFPIINVHWQATNDEATYIVTAKGEAGLYHCTSSGEFCTITDLPCGS
IFSISAVAQTEAGQSLPSYSVPLETVPCCPADLKVIQVTQSVTNVSWTSGTGAQTYVTIL
ESPKGQSKCHTLQNHCILGCISCGTNYTVALKAISATGLTAVCTYQDYSSSACCPLGVKL
YLLGNNGIRICWRTSVGSANYRAELYGSKGIFTCTPSSALSYCDITEILCGDVYTVMVSP
VDEMGSKLTFCPQKIYSGKLRPIPGHPVN
Download sequence
Identical sequences F6YCN9
ENSMODP00000002834 ENSMODP00000002834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]