SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002864 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002864
Domain Number 1 Region: 346-505
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.93e-22
Family Toll/Interleukin receptor TIR domain 0.002
Further Details:      
 
Domain Number 2 Region: 103-169
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000385
Family I set domains 0.04
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002864
Domain Number - Region: 198-286
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000215
Family I set domains 0.038
Further Details:      
 
Domain Number - Region: 23-80
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00382
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002864   Gene: ENSMODG00000002351   Transcript: ENSMODT00000002920
Sequence length 526
Comment pep:novel chromosome:BROADO5:7:65842460:65875771:-1 gene:ENSMODG00000002351 transcript:ENSMODT00000002920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQPFALSSTTNTMKNGNGNVTCYKNSSKTPITTNRNSRVHQYQNWILFLPLTSEDSGIYE
FVIRDLECCQRISMNLTVQNRNSGWCGDSNKDLAVLAYNSNYQTLNIGITTMLKCHIITF
PNKTLSPIQWYKECKLIEDKKKFLPIGSDLYIQNTTAEDAVTYSCKTKLTYMGKQYDILN
RISTRTRNNTEARKIPEIFSPKNNSIEVPLGSPLIVNCSIKDWKGNSHHRSWKVNNTFVD
FLNSSRIREGVETEVACGEKYIFYTVNISFSEVRQEDYDRHFTCLSGSSAAFIMLKHPAP
NVQGYLIGGTFAVLFVIMFVMCTYYAVKVDLVLWYRSTFHSALSGEDGKLYDAYVLYPKP
KTESQGQHMNVLVLKILPEVLERQCGYRLFIFGRDDLPGQAVVNVIDENIKLSRRLIIIL
VPECSSYGLLKNMSEEQITIYNALIQDGMKVILIELEKIQDYTDMPESIKYLKQKHGVLQ
WKGDSMQGLHSAKTKFWKNVRYRMPPKRYPCFTKELNLSNQNEINT
Download sequence
Identical sequences F7GLK0
ENSMODP00000002864 ENSMODP00000002864 13616.ENSMODP00000002864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]