SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002893 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002893
Domain Number 1 Region: 28-122
Classification Level Classification E-value
Superfamily Immunoglobulin 6.02e-22
Family I set domains 0.00083
Further Details:      
 
Domain Number 2 Region: 315-410
Classification Level Classification E-value
Superfamily Immunoglobulin 3.11e-20
Family I set domains 0.002
Further Details:      
 
Domain Number 3 Region: 125-219
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-18
Family I set domains 0.0044
Further Details:      
 
Domain Number 4 Region: 231-312
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000263
Family I set domains 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002893   Gene: ENSMODG00000002375   Transcript: ENSMODT00000002950
Sequence length 410
Comment pep:novel chromosome:BROADO5:4:407875144:407891468:1 gene:ENSMODG00000002375 transcript:ENSMODT00000002950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPALSVLLCLEGGSPGPNSSPSLPDGLPKPSLRAENGSLVPQGRNVTLRCRGSWEAEEW
RLEKKRGYGWSESKTVRQAGNEGEFSLLSVTSNDAGTYRCLYRHSSYGWAEPSDPLELVV
TGLSAPPSLAALPGSEVEEGQNVTLQCRSEGWYDSCVLYKDGEEISRSTQSHGRRCQIDV
FFAAVNLTQDGTYQCFSFDSPYPHEWSSPSAPLLLRVSGEAAPAPPSVSQDPFLPWGTSL
PAQGLGSLWGDKFRVKRNTSVVPGTSGQAGNEGEFSLPSVTSHDAGTYRCLYRHSSSWWS
QLSDPLELVVTGLSAPPSLAALPSSAVVSGQNVTLQCWSELYYGWFALCKDREEISGGRT
RSHGRMYQADFFFPAVTLTNNGSYGCFGYHSSSPSLWSSPSAPLVLWVSG
Download sequence
Identical sequences F7G306
13616.ENSMODP00000002893 ENSMODP00000002893 ENSMODP00000002893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]