SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002903 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002903
Domain Number 1 Region: 354-513
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.49e-32
Family Toll/Interleukin receptor TIR domain 0.00024
Further Details:      
 
Domain Number 2 Region: 25-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000128
Family I set domains 0.035
Further Details:      
 
Domain Number 3 Region: 125-232
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000151
Family I set domains 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002903
Domain Number - Region: 209-313
Classification Level Classification E-value
Superfamily Immunoglobulin 0.025
Family I set domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002903   Gene: ENSMODG00000002385   Transcript: ENSMODT00000002961
Sequence length 534
Comment pep:novel chromosome:BROADO5:7:66020612:66054433:1 gene:ENSMODG00000002385 transcript:ENSMODT00000002961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLRVLVVIFLIFVEGNNSEECVERSFITALEGEPFHLKCCLSARRHHKNKTFTWTKRYG
RNSTMKLSSNENIIINGSVIEFWPIKMNDNGIYSCIAGNENKSWTISVTKKNRHGCFHPN
HLITIEADVGKSLSINCIDDYYQKKDHRISLFKNCSPIPGNYRSSILKNAELKDEGNYTC
IFFLSNKYGSFNVTKTFRVKVKDNISRVPKLFGNMTNYVEAELGKKKTLNCTAILDGTDG
RLYWDYMEENDTNININKINSRCDSNAMTRVSSLLEIKIVKEENLNMWYNCTLSSPSITE
TIAYFLKKKEGPADISRHIFIIALVSSAAVIFLVIMCVIYRVDILLCYRDFLRRDETLLD
GKEYDAFVSYLKDCQSENGEEHKFALEILPEALEKHFGYKLCIFERDIIPGGAIVDDIHS
LINKSRRLIIVLSENYMSSKVKYELESGLHEALVERKIKIILIEFTPIRDFTFLPQSLKL
LKSHRILKWKADKSLPYNSRFWKNLRYLMPAKNTKNVFSSDPLGNELLPVVSKF
Download sequence
Identical sequences F7F019
ENSMODP00000002903 ENSMODP00000002903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]