SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002906 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002906
Domain Number 1 Region: 272-365
Classification Level Classification E-value
Superfamily Immunoglobulin 6.79e-22
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 141-236
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-17
Family I set domains 0.0056
Further Details:      
 
Domain Number 3 Region: 44-140
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-16
Family I set domains 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002906
Domain Number - Region: 235-269
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00297
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002906   Gene: ENSMODG00000023697   Transcript: ENSMODT00000002964
Sequence length 440
Comment pep:novel chromosome:BROADO5:4:387475453:387501409:1 gene:ENSMODG00000023697 transcript:ENSMODT00000002964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLEELKRVAVYAFEGHKEKEKKNTDVVEALRKEIKQMAAKQGLPKPDIFAEPSSVVAPG
TNVSLHCSAFQLTPWELLFTLLKAENPGYVLEDKTGRQVRFSLPSVKVRDAGSYSCFYSE
RRSAKGKSETSETLDLVVTGLPKPDIFAEPSSVVAPGTNVTLRCSALQSTSQELLFTLSK
AGSPGYPHPEKTGSEARFSLPSVKVRDAGSYSCFYSERRHAKGKSETSETLDLVVTVQDA
GSFRCVYYEKTVQPRASEPSEPLYVCVTDSLTRPSLTVEPSSSVSLGEKVTLWCQSASCG
TRFTLYKDGEDKPVQTIDSPQDKAGFLIPRVTRNDTGTYYCLHHTGEDIPTPAWLSDPLE
LSVSGKHDGPFPEKDIRTILTIALSCIAILPFLALLGCCLHHLGLQDGIPCTREHPKRKS
HATEEDNRPPESHRFLDLAL
Download sequence
Identical sequences F7F007
ENSMODP00000002906 ENSMODP00000002906 13616.ENSMODP00000002906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]