SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002908 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002908
Domain Number 1 Region: 225-318
Classification Level Classification E-value
Superfamily Immunoglobulin 6.27e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 525-617
Classification Level Classification E-value
Superfamily Immunoglobulin 6.12e-20
Family I set domains 0.031
Further Details:      
 
Domain Number 3 Region: 123-222
Classification Level Classification E-value
Superfamily Immunoglobulin 2.68e-18
Family I set domains 0.0086
Further Details:      
 
Domain Number 4 Region: 420-516
Classification Level Classification E-value
Superfamily Immunoglobulin 8.89e-18
Family I set domains 0.0047
Further Details:      
 
Domain Number 5 Region: 25-121
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-17
Family I set domains 0.005
Further Details:      
 
Domain Number 6 Region: 320-419
Classification Level Classification E-value
Superfamily Immunoglobulin 1.21e-16
Family I set domains 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002908   Gene: ENSMODG00000002387   Transcript: ENSMODT00000002966
Sequence length 620
Comment pep:novel chromosome:BROADO5:4:387296368:387401374:1 gene:ENSMODG00000002387 transcript:ENSMODT00000002966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPISMVLLCLGLCLYQGIKAQKGLPKPVLFAEPSSVVAPGTNVTLGCSALELTSQELLF
TLSKAGSPGYPHPKKTGSEARFSLPSVKVRDAGSYSCFYSERRPAKGKSETSETLDLVVT
GSLPRPSLRALPNAKVSLNGRVTLRCVRPVKPSLGSVMFMWLKAGTPEPLGRSLQQSQTW
ADFTLPSVTVQDAGSFRCVYYEKTVQPRASEPSEPLHVCVTDSLTRPSLTVEPSSSVSLG
EKVTLWCQSASCGTSFTLHKDGEDKPVQTIDSPQDKAGFLIPRVTREHAGTYYCLHHTGE
DIPTPALYSDHLELSVSGSLPQPSLQALPSANVSLNGRVTLRCIHPATPSLGSVMFMWLK
AGTPEPLGRALQQSHRWTDFILPSVRVQDAGSFSCVYYEKTAQPRASEPSEPLNICVTGL
PKPDIFAEPSSVVAPGTNVTLRCSALQSTSQELLFTLSKAGSPGYPHPEKTGSEARFSLP
SVKVRDAGSYSCFYSERRHAKGKSETSETLDLVVTGKKMPQRGLRPSLTVEPSSSVSLGE
KVTLWCQSASCGTRFTLYKDGEDNPVQIIDSPQDKAGFLIPRVTHNDTGTYYCLHHTGED
IPTPALYSDHLELSVSGEQE
Download sequence
Identical sequences F7F000
ENSMODP00000002908 ENSMODP00000002908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]