SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002920 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002920
Domain Number 1 Region: 124-219
Classification Level Classification E-value
Superfamily Immunoglobulin 2.55e-22
Family I set domains 0.0013
Further Details:      
 
Domain Number 2 Region: 27-121
Classification Level Classification E-value
Superfamily Immunoglobulin 3.85e-21
Family I set domains 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002920   Gene: ENSMODG00000002399   Transcript: ENSMODT00000002978
Sequence length 240
Comment pep:novel chromosome:BROADO5:4:408064843:408066918:1 gene:ENSMODG00000002399 transcript:ENSMODT00000002978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPALSVLLCLGLCLCKRTRTQAAGEFHKPSLWAENGSLVPQGGAVTFFCWGSWKAVEWR
LEKNGGSRCSEIKAMEGARNEGKFSLPSVTADNAGTYCCSYRHLFYGWSEHSDPLELVVT
GLSAPPSLAALPSSEVAPGQNVTLQCRSELYYDWCVLCKDGEEISRGRTQCHGRGRQAEF
LFPAVTPTQNGTYRCFGFPSSSPSQWSAPSAPLVLWVSGEAAPAPPSPSQPLPPTQPSQA
Download sequence
Identical sequences F7EHL7
ENSMODP00000002920 ENSMODP00000002920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]