SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002923 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002923
Domain Number 1 Region: 390-552
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 9.68e-29
Family Toll/Interleukin receptor TIR domain 0.00067
Further Details:      
 
Domain Number 2 Region: 241-343
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000119
Family I set domains 0.032
Further Details:      
 
Domain Number 3 Region: 73-140
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000599
Family I set domains 0.049
Further Details:      
 
Domain Number 4 Region: 156-221
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000874
Family I set domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002923   Gene: ENSMODG00000002401   Transcript: ENSMODT00000002981
Sequence length 569
Comment pep:novel chromosome:BROADO5:7:66102527:66136167:1 gene:ENSMODG00000002401 transcript:ENSMODT00000002981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLHHIFLWLVIRAGVKGDSELSGCPTKSSWRYLARSGEKFFLFCDVPRRGRISKKDIC
GKTRCHDISCSSDVRWYKHPQNGSQPYAILNEHSHITWENHLLQFSPVGINDAGFYICTF
KYEPKGITCFLNITLEVQPKEKTPCLDSVKNELFLLIGSTDRVPCPGINCERDIQSEVTW
YKNGTLCPRWTSTHIEFTEIFYRDRGVYVCDYKKSINSTWWIVRAVVDVIAVVKNTSSKP
TILYPTVDMLTLEVELGKPLTLDCKAQFEFERNFNPVIKWFVDDPGLNRKELREGNKSIE
NDVEQKTIHFIAHLKEVTKKDLRRNFICFAQNSVGNTTLTIKLKQKKGVLFTYILFGTTI
TLVAILMTSALTYRYWIEIVLLYRTYQAKDETLGDKKEFDAFVSYARDSFGDLDSSSLNE
ESFALDLLPQVLENKYGYTLCLFERDVIPGGAYTEDIVKIIKQSRRVICVLSSSYVNNPS
VFELQAAVNLALEDQTLKLILIKFSPFKEPDSLPQRVRKALSVLPTITWKNSKSAPPNSR
FWSRIRYHMPVKNCRKLGSQGFHFFPRIF
Download sequence
Identical sequences F7EHK1
13616.ENSMODP00000002923 ENSMODP00000002923 ENSMODP00000002923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]