SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002962 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002962
Domain Number 1 Region: 151-346
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.42e-60
Family Astacin 0.0000753
Further Details:      
 
Domain Number 2 Region: 778-885
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-38
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 353-462
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-37
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 4 Region: 467-571
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-36
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 5 Region: 618-728
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-35
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 6 Region: 909-1003
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-26
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 7 Region: 729-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000479
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 8 Region: 574-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000344
Family EGF-type module 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002962   Gene: ENSMODG00000002435   Transcript: ENSMODT00000003022
Sequence length 1013
Comment pep:novel chromosome:BROADO5:5:106528242:106783459:-1 gene:ENSMODG00000002435 transcript:ENSMODT00000003022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMEMLSQRMVLWLMASGLIFSGEMWVSTGFDYDYTYTLHEEDKTETLDYKDPCKAAIFW
GDIALDDEELRVLQIDRTIDLTQNSFEKLGHITGGLGDHGVSKKRGALYQLIDRIRRFGS
GLEQNSTAKGKASVKFSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQ
AMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVH
ELGHVIGFWHEHTRPDRDKHVTIIRENIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYA
RNTFSRGMFLDTILPARDENGIRPAIGQRTRLSKGDITQARKLYRCPACGETLQESTGNF
SSPGFPNGYPSYTHCIWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLL
GRFCGDKVPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIHKNEGQIQSPNYPD
DYRPMKECVWKIIASENYNVGLTFQAFEIERHDSCAYDYLEIRDGSSENSPLIGHFCGYD
KPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDNGGCEQRCVNTLGSYQCA
CEPGYELGPDKRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCIWQVVAPTQYRISMKF
EFFELEGNEVCKYDYVEIRSGLSSDSKLHGKFCGAEVPEVVTSQFNNMRIEFKSDNTVSK
KGFKAHFFSDKDECSKDNGGCQHECINTVGSYVCHCRNGFVLHENKHDCKEAECEQKIHS
PSGMITSPNWPDKYPSRKECTWEISATPGHRVKLAFSEFEIEQHQECAYDHLEVFDGETE
KSPILGRLCGNKMPDPLVATGNKMFLRFVSDASVQRKGFQARHSTECGGRLKADSNPRDL
YSHAQFGDNNYPVQVRCEWLLMSERGSSVELIFQTFEVEEEADCGYDYVQIFDGHDSTAR
NLGRFCGSGPPEEIDSSGDAILIYFHTDDTINKKGFHIRYKSIKYSDTTHTKK
Download sequence
Identical sequences F7DZV7
ENSMODP00000002962 XP_001365917.1.35504 XP_007496213.1.35504 XP_016278619.1.35504 ENSMODP00000002962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]