SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002996 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002996
Domain Number 1 Region: 23-69,103-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000218
Family V set domains (antibody variable domain-like) 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002996   Gene: ENSMODG00000002467   Transcript: ENSMODT00000003059
Sequence length 645
Comment pep:novel chromosome:BROADO5:2:58663893:58745480:-1 gene:ENSMODG00000002467 transcript:ENSMODT00000003059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRMSLGWIVLFWVTGVAEGLQVIVPEKTKKAMLFQPVVLSCRFSTSSQQPAVIQWKFKS
YCQDRMKEALGMATAGAQPLSKRNLEWDPYLDCVDSRRTVRVVASKQGAVVTLGEFYRGR
DITFGEGAELKIGKVMWGDSGLYYCIVTTPDDVEGKNEDSVELLVLGRTGWLAALLPSFA
VKIMSEWVFVGLVILGVFLFFLLVGICWCQCCPHSCCCYVRCPCCPDSCCCPRALYEAGK
AAKSGYPPSVSSVPGPYYIPSVPVGGVSSSAMLMDKPHPPPLASSDSIGGSQSVRKGYRI
QADKERDSMKVLYYVEKELAQFDPARRMRERYNNTISELSSLHEDNGNFCQSYRQMRRKP
LPSLGNIESDTDYWTGVMGNSGGSGHGPSSSNYNKEDRDSFRHSQQRCKSEMLSRKNFAM
GMPAVSMDELAAFADSYSQRSHRGEGNSQEPRGGSRFERSESRAHGGLYHDGSLEEYYSK
RSRSREPLTDSDRGWSYSPPRRRANEDKHLPRLVSRTPGVGQKYDHPYLSSVLERKSRGE
GSSGGGSLETPSKRSSQPIQRSGSYYAWSPPSTYKAGSGQQPSPQAGEEDEMEDALPPYS
ELELTRGPSYRGRESLYHSNSEKKRKKDSLKKTVRPRLVLLIQVG
Download sequence
Identical sequences F7DDQ8
ENSMODP00000002996 ENSMODP00000002996 XP_016285418.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]