SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003023 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003023
Domain Number 1 Region: 22-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000129
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 
Domain Number 2 Region: 137-231
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000048
Family I set domains 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003023   Gene: ENSMODG00000002491   Transcript: ENSMODT00000003088
Sequence length 314
Comment pep:novel chromosome:BROADO5:2:58816291:58868452:-1 gene:ENSMODG00000002491 transcript:ENSMODT00000003088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGKMRTLLFILYAFWGTAHAISVVTPTKVLRVARGSSATLPCFYMTTVPGRDGFIQWDK
PLTTPPDSVVIWSFSSKEYTFGTRYTNRVNMTGNYLKDEASITIDQLTMDDNGTYECQMM
LNGDLDGNRQSRMDVLVLVAPSKPDCGIEGETVYGNDIKLTCQSKEGSPVPQYSWKRFDT
ENKERPLSPPATGTTLLLKNISADTTGFYICTSTNEVGTQFCNITVAIRPPSMNIALYAG
IAGGVVAALIIIGIIAYCCCCKGNKEKDRERPNREDYQEPSEKREMRRRNDDEEEGRNQD
RWSSGEGSPTPSTR
Download sequence
Identical sequences F7BVN1
XP_007480766.1.35504 ENSMODP00000003023 ENSMODP00000003023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]