SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003024 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003024
Domain Number 1 Region: 81-343
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.69e-55
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 32-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000428
Family Complement control module/SCR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003024   Gene: ENSMODG00000002494   Transcript: ENSMODT00000003089
Sequence length 345
Comment pep:novel chromosome:BROADO5:1:702880216:702883035:-1 gene:ENSMODG00000002494 transcript:ENSMODT00000003089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QWAMGTFSRLSFVGDLIWCLNLILLFLSDDICPRPPPVANGYVEHAVRYKCNKFYRLKSD
GDGLYTLNEEKQWTNKDVGGKLPECVAVCGKPANPLNPVQRIIGGILDAKGSFPWQGRMV
SWKNLTSGATLISDQWLLTTAKNIFLSHAENATLKDIVPTLKLFLGKKLVDIDQVILHPS
HSTVDIGLIKLKSKVLVNEKVMPICLPQKDYVEVGRVGYVSGWGRNTNFVFTERLKYVML
PVADNDKCVEYYEGSTDPEKKKAKSPIGVQPILNQHTFCAGMTKFQEDTCYGDAGSAFAI
HDEDDDTWYAAGILTFDKSCSVAEYGVYTKVPSILDWIQETMATN
Download sequence
Identical sequences F7BVM7
ENSMODP00000003024 13616.ENSMODP00000003024 ENSMODP00000003024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]