SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003028 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003028
Domain Number 1 Region: 28-122
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-21
Family I set domains 0.0012
Further Details:      
 
Domain Number 2 Region: 121-152
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000232
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003028   Gene: ENSMODG00000002490   Transcript: ENSMODT00000003093
Sequence length 155
Comment pep:novel chromosome:BROADO5:4:408734186:408736514:1 gene:ENSMODG00000002490 transcript:ENSMODT00000003093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPALSVLLCLGEGIPWTYESHSLPDRLPKPSLWLENGRPLVPAGRNVTLSCQGSQSAHL
YRLEKRQYANWSMIMDVRATGSEAKFFIPSVTANHAGSYNCIYRHSSQWSERSDPMELVV
TDLYDQPFLSALPGSEVASGQNVTLQCWSKQSHDW
Download sequence
Identical sequences F7BA41
ENSMODP00000003028 ENSMODP00000003028 13616.ENSMODP00000003028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]