SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003102 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003102
Domain Number 1 Region: 166-226,378-443
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000909
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 49-158
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000248
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 
Domain Number 3 Region: 174-217,317-355
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000117
Family I set domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003102   Gene: ENSMODG00000002553   Transcript: ENSMODT00000003168
Sequence length 468
Comment pep:novel chromosome:BROADO5:4:372652170:372953169:-1 gene:ENSMODG00000002553 transcript:ENSMODT00000003168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKLSIIGSIVYSHVAKFGRTKGGLSSTRSQPLYTQGYLTVSIEPLPPVVVGDAVTLKCN
FKTDGRMREIVWYRVTDGGTIKQKIFTFDAMFSTNSSHMENYRKREDLVYQSTVRLPEVR
ISDNGPYECHVGIYDRATREKVVLASGNIFLNVMSPPTSIAVVAADTPAPFSRYQAQNFT
LVCIVSGGKPAPVVYFKRDGEPIEAVSLSEPAVGTAALQDSRAFRSLLHRDLDDTKMQKS
LSLLDAEGRGGHPYTEGPFRGLTPDPSLVLQPTTENIPETVVSREFPRWVHSAEPVYFLR
HSRAPGSDGTVEVRALLTWTLNPQVDNEALFSCEVKHPALSMPMQAEVTLVAPKGPKIMM
TPTRARVGDTVRILVHGFQNEVFPEPLFTWTRVGSRLLDGSTEHDGKELVLERVPAELNG
SMYRCTAQNPLGSTDTHTRLIVFENPNIPRGTEDSNGKLLLVALPNGN
Download sequence
Identical sequences F7GFE2
ENSMODP00000003102 ENSMODP00000003102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]