SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003158 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003158
Domain Number 1 Region: 424-566
Classification Level Classification E-value
Superfamily PR-1-like 4.32e-41
Family PR-1-like 0.000000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003158   Gene: ENSMODG00000002601   Transcript: ENSMODT00000003226
Sequence length 569
Comment pep:novel chromosome:BROADO5:6:27014708:27097623:1 gene:ENSMODG00000002601 transcript:ENSMODT00000003226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPGEGPSHRNRQKYSLKETSNVTIEDLKKGHRVPKNEVEMMEHQKALSTDWESRSEDME
IVDVGIEDFRIEGSETLFQVLQDYEHKDEDLRMVEMEQDQSSKPAAKEEGQKSQPTDNWI
TTPTHSNSWRRINLSHEDLELLKEADQSLSQSMSKSSKYKHQADSLLSLANRVEEYEKIW
QQPDNPTEAYHLLPVLKKQLNLLISESTRRFLRSSQTISLPGDQMDHKSKEGPSKGQSTS
KSPKTPRNSLSTKTPKEKDDGKVDEDEDEEDPPVYKDMVLSLLLQLKKHENLLNSLSTSR
SRMSSPTFSLPEDQMDQNRNSKEELWKGQLTAPSSSKSLRPLSRKSLKGSQSGSRDLSKL
MSSLFSRLANEPSTPEEKEGKVDEDKDEDKDEDEDEDKDEDEDEDKDEDDFDFPLYQNPE
SKMFAKSVLKSHNDYRQKHGCPPIKICQKLNHEAQQYADALATTKVLKHSSESSRGNCGE
NLSWASYDQPGHEVADRWYSEIRNYDYKSPGFTPESGHFTAMIWKGTKKMGVGKASANDG
SSYVVARYFPAGNVVNPGLFEENVPRPKT
Download sequence
Identical sequences F7G4V6
ENSMODP00000003158 ENSMODP00000003158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]