SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003188 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003188
Domain Number 1 Region: 18-188
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-72
Family Ephrin receptor ligand binding domain 0.000000332
Further Details:      
 
Domain Number 2 Region: 316-412
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000019
Family Fibronectin type III 0.0066
Further Details:      
 
Domain Number 3 Region: 246-320,355-376
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000113
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003188   Gene: ENSMODG00000002627   Transcript: ENSMODT00000003256
Sequence length 454
Comment pep:novel chromosome:BROADO5:2:540531194:540538285:1 gene:ENSMODG00000002627 transcript:ENSMODT00000003256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAEHLTFLFFLLSLNPSETLMNTKWVTSELAWTPHPETGWEEVSGHDSSTNPIRTYQVCN
VRESNQNNWLRTGFIRRREVQRVYVEIEFTVRDCNSIPNIPGSCKETFNLFYYEADSDVA
SASSPFWMENPYIKVDTIAPDESFSRLDSGRVNTKVRSFGPLSKAGFYLAFQDQGACMSL
LSVRVFYKKCARTIASFALFPETLTGAEPTSLVIAPGTCIPNAVEVSVPLKLYCNGDGEW
MVPVGACTCAAGYEPAAKETQCQACPPGSFKAKQGEGPCLPCPPNSRTASAAATICVCHN
NFYRADSDTADSACTTVPSPPHSVISNVNETSLVLEWSEPRDLGGRDDLLYNVICKKCQG
GAGAGSASCSRCDDNVEFVPRQLGLTERRVHVSRLLAHTRYSFEVQAVNGVSGKSPLPPR
YAAVNITTNQAGEEGARQTAALCGYLHVGTFVGR
Download sequence
Identical sequences F7FUF5
ENSMODP00000003188 13616.ENSMODP00000003188 ENSMODP00000003188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]