SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003258 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003258
Domain Number 1 Region: 111-210
Classification Level Classification E-value
Superfamily Immunoglobulin 5.36e-19
Family I set domains 0.0075
Further Details:      
 
Domain Number 2 Region: 13-109
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-18
Family I set domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003258   Gene: ENSMODG00000028671   Transcript: ENSMODT00000003327
Sequence length 213
Comment pep:novel chromosome:BROADO5:4:387206024:387215202:1 gene:ENSMODG00000028671 transcript:ENSMODT00000003327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLISMVLLCLGLPKPDIFAEPSSVVAPGTNVTLRCSALQSTSQELLFTLSKAGSPGYPH
PEKTGTEGRFSLPSVKVRDAGSYSCFYSERRPAKGKSETSETLDLVVTGSLPRPSLQALP
SAKVSLNGRVTLRCVLPVKPSLGSVMFMWLKAGIPEPLGRALQQSQRWADFTLPSVTVQD
AGSFRCIYYEKTVQPRASEPSEPLNVCVTGEKG
Download sequence
Identical sequences F7CYL6
ENSMODP00000003258 ENSMODP00000003258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]