SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003309 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003309
Domain Number 1 Region: 709-1002
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.27e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000194
Further Details:      
 
Domain Number 2 Region: 1006-1292
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-74
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000144
Further Details:      
 
Domain Number 3 Region: 1-204
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.57e-64
Family Carbonic anhydrase 0.000019
Further Details:      
 
Domain Number 4 Region: 231-324
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000298
Family Fibronectin type III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003309   Gene: ENSMODG00000002722   Transcript: ENSMODT00000003378
Sequence length 1327
Comment pep:novel chromosome:BROADO5:6:213506016:213884902:1 gene:ENSMODG00000002722 transcript:ENSMODT00000003378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNTGKTVAILLKDDYFISGAGLPGRFKAEKVEFHWGHSNGSAGSEHSINGRRFPVEMQI
YFYNPDDFDSFQTAISENRIIGAVAVFFQVSQRDNPALDPIIHGLKGVVHHEKETFLDPF
VLRDLLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQMEAFYSIFTTEQQDHV
KSVEYLRNNFRPQQNLNDRVVSKSAVKDAWSHDMTDLENPLGTEASKVCSTPPVNMKVHP
VNRTALLVTWSQPETIYHPPLMNYMISYSWTKNEDEKEKTFTKDSDKDLKAIISHVSPDS
LYLFRVQAICRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGS
STWTSSGIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAGLGFSGGGISSFPSTVWPTR
LPTAASASKQSARAVVATTEALSSPAPEGDSALTKDGEGAEEGEKDEKSESEDGEREHEE
EGEKDAEKKEKSGVTHSTEVQNRTEPTLGPAAPDRTVEEDQNETRAGPEPEPSVLPTEPG
GERRETAAEPSAEPVASTQVPSTVTGPQDAGGAPRRPETPSKKPSSRGDRFPDDKFITVN
PDKNTSSMVTRASAGRMDWIIPLIVVSALTFVCLILLIAVLVYWRGCNKIKSKGSPRRFR
EVPSSGERGEKGSRKCFQTAHFYVEDSSSPRVVPNESIPIIPIPDDMEAIPVKQFVKHIS
ELYSNNQHGFSEDFEEVQRCTADMNITAEHSNHPDNKHKNRYINILAYDHSRVKLRPLPG
KDSKHSDYINANYVDGYNKAKAYVATQGPLKSTFEDFWRMVWEQNTGIIIMITNLVEKGR
RKCDQYWPTENSEEYGNIIVTLKSTKIHACYTVRRFSVRNTKVKKGQKGNPKGRQNERIV
IQYHYTQWPDMGVPEYALPVLTFVRRSSAARTPDMGPVLVHCSAGVGRTGTYIVIDSMLQ
QIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVASNQLHSYVNS
ILIPGVGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVVPAERARVGLAPLP
GMKGTDYINASYIMGYHRSNEYIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAED
EFVYWPSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLEVRHFQCPK
WPNPDAPISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVD
VFQVAKMINLMRPGVFTDIEQYQFVYKAMLSLVSTKENGNGPMTVDKNGAILIADESDPA
ESMESLV
Download sequence
Identical sequences F6Z7H9
ENSMODP00000003309 ENSMODP00000003309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]