SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003416 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003416
Domain Number 1 Region: 281-374
Classification Level Classification E-value
Superfamily Immunoglobulin 9.89e-26
Family I set domains 0.0045
Further Details:      
 
Domain Number 2 Region: 448-549
Classification Level Classification E-value
Superfamily Immunoglobulin 8.74e-25
Family I set domains 0.0043
Further Details:      
 
Domain Number 3 Region: 1167-1261
Classification Level Classification E-value
Superfamily Immunoglobulin 4.72e-24
Family I set domains 0.0083
Further Details:      
 
Domain Number 4 Region: 1266-1361
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 1036-1130
Classification Level Classification E-value
Superfamily Immunoglobulin 7.01e-22
Family I set domains 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003416
Domain Number - Region: 814-819
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00173
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003416   Gene: ENSMODG00000002837   Transcript: ENSMODT00000003487
Sequence length 1365
Comment pep:novel chromosome:BROADO5:5:102438386:102929370:-1 gene:ENSMODG00000002837 transcript:ENSMODT00000003487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETSSHESFYDSLSDVQEDTKNADFFPELSAFLSQEEINKSLDLAREAIANSEVEDSDS
EKEITHIFKTSPSSLCEKTSQKETKLAEKRTPTMPQGNRPIRSQTLPEQEPPVPQNRSIS
SPMSKRKPVGSPLLTASPSYIRSLRNAERRGPKALNLSAKSKSVSQGGLGSQSQLRDKAA
NLIEELSSIFREAAKPRNRNLNGESSSPDSGYLSPKNQPSTLSTSASQSPTEDHPAMETE
VKLPTANHLNNYCQKSQAITQSGNGIFHKPLHDPMSLPAAPRFTQKLRSQEVAEGSRVYL
ECRVMGNPVPRVRWFCEGKELQNSPDIQIQCESGGLHTLVIAEAFEDDTGRYSCLATNPN
GSDTTSAEVFIEGASSSDSDSENLAFKSKAGDMPQAQKKTTSVSLTIGTSSPKTGVTTAV
IQPISVPVQQVQSPTSYLCRLDGANSAYTPPNFTKELQNITASEGQVVVLECRVRGAPPL
QVTWFREGIEIQDSPDFRILQKKPRSTAEPEEICTLVIAETFPEDAGIFTCSARNEYGSV
TSTAELVVNSANMENYSHDSMKQSNSDDFQHDPPPPPPLEISSFEMTPEKPPESHPVTNP
ELGPGMTDLQLQLNSARRETNGIHLNHGVNGLINGKANGNKSALKPAVLLSPTKEPPPLL
AKPKLDPLKIQQLQNQIRLEQEGSQWYHQQSSAPQNPPPSPPFPPPPSFQELEASQSVSF
PDQMNVLTSHSSPVMQSSSSFNYARPKQFIAAQNISPASGYVTPSSSSSTSSLPSPMSPT
ATQKQFGRVPVPPFSQPFPSEGEFQWSPSSPSPPPPPPPVFSPTTAFPMSDSFPLPPPPP
PPLPGSAPSPSFCPSPNARFGHSNQTPAAFLSSMLPSQPAPVAVNALGLPKSVTPVGFPK
KAGRTARIASDEEIQGTKDAVIQDLERKLRFKEDLLNNGQPRLTYEERMARRLLGADSAT
VFNIQEPEEEPVSQEIESLHASSIVNSQDGQKEYKVSSCEQRLISEIEYRLERSALDDSG
DELQQGDGPMENGVAPYFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISTRS
DHYSIQRDPDGTCSLHTTASTLDDDGNYTILAANPQGRVSCTGRLMVQAVNQRGRSPRSP
SGQPHVRRPRSRSRDSGDENEPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPD
LSWQLNGKPIRPDSAHKMLVRENGIHSLVIEPVTSRDAGIYTCVATNRAGQNSFSLELIV
AAKEAHQAPAFLEKLQNTGVADGYPVRLECRVSGVPPPQIFWKKENESLTYSTDRVSMHQ
DNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARLDVYISRH
Download sequence
Identical sequences F7EJF7
XP_007496204.1.35504 ENSMODP00000003416 ENSMODP00000003416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]