SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003499 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003499
Domain Number 1 Region: 27-120
Classification Level Classification E-value
Superfamily Immunoglobulin 9.48e-20
Family I set domains 0.0011
Further Details:      
 
Domain Number 2 Region: 122-191
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000269
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003499   Gene: ENSMODG00000002874   Transcript: ENSMODT00000003576
Sequence length 191
Comment pep:novel chromosome:BROADO5:4:408620683:408624935:1 gene:ENSMODG00000002874 transcript:ENSMODT00000003576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPILCALLSLGLCLGQRMRTQAAGTLPRPSLRAENGSLVPQGGAVTFQCRGSEKAEFYR
LEKMEGSERKDIKDVLKAEIEVEFSLSSVTWSHAGIYYCRYFHSTCWSESSNPLELVVTG
HHDQPWLEAWPSSEVASGQNVTLQCWSKQLYDWSVLYKDGEKLTQNKFLPGLGGYKAAFS
ILDVTPTHGGT
Download sequence
Identical sequences F7E1X7
ENSMODP00000003499 ENSMODP00000003499 13616.ENSMODP00000003499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]