SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003551 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003551
Domain Number 1 Region: 127-221
Classification Level Classification E-value
Superfamily Immunoglobulin 3.66e-22
Family I set domains 0.0023
Further Details:      
 
Domain Number 2 Region: 26-125
Classification Level Classification E-value
Superfamily Immunoglobulin 8.05e-16
Family I set domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003551   Gene: ENSMODG00000002904   Transcript: ENSMODT00000003628
Sequence length 410
Comment pep:novel chromosome:BROADO5:4:386796238:386810166:1 gene:ENSMODG00000002904 transcript:ENSMODT00000003628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSTLCSLLCFGLYLSQRIQAQEGSLPKPTLSLETDLMIAPRSNLSLKCKKPDSDHIPQR
WTYLLLKEGNSQPLQNHTATGSWAKFSLLSVTTQDSGNYSCKYLEFQNPQRESEASSALE
IWVKDILQKLSLSALPQRIITPGENVTLLCHGPAWGMRFALYKEGDEKPMQIHDPIQDEA
EFLLTYVTTNHTGNYSCHHHSDAVNQVMAQPSDPLELIVKGELDIPLRQAPPHMILSLVS
CAYLSQIHYCFSFLALSENYRLFFILVFFLQTSGADDYGGVTYSQLNIKTMRKGTQPCCS
RQRSSGFFSTPWAVTVIAQNHTNDNKNQRSQADTNEIVHRISCIGKKGEMDANKSQRCPS
WYPGGAILPPLSSTVFQCPERDFPTAVKISASKPVTDCGGRHGAILGPTQ
Download sequence
Identical sequences F6PMX9
ENSMODP00000003551 ENSMODP00000003551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]