SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003676 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003676
Domain Number 1 Region: 168-274
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-17
Family I set domains 0.039
Further Details:      
 
Domain Number 2 Region: 33-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000188
Family Growth factor receptor domain 0.0023
Further Details:      
 
Domain Number 3 Region: 120-166
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000305
Family Ovomucoid domain III-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003676   Gene: ENSMODG00000003028   Transcript: ENSMODT00000003759
Sequence length 292
Comment pep:novel chromosome:BROADO5:6:31307137:31375367:-1 gene:ENSMODG00000003028 transcript:ENSMODT00000003759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRFTLPPFLLLSLLFCLRSYRLTGANDGGNTSECGPCIPESCEPVRCQAPELSVRDACG
CCEQCLGAEGELCGGRGGAGRRRQARCGPGLVCVSQSREVLGAAASQAPLPEELEGTGLC
VCKEDGAVCGSDGRSYQSVCALHLHSWISVRAGRERVHKAHDGECKLAPVIVMPPKKIHN
VTGAQVYLSCEVKAVPTPIITWRKITESPKGVKLLEELPGDRVNMAVQVRGGPSKHESTG
WVLINPLTKEDEGVYQCHATNMVGETQSYGTIKVTDLSKYKKMNFIGPDDDM
Download sequence
Identical sequences F6Q1Y4
13616.ENSMODP00000003676 ENSMODP00000003676 XP_001372431.1.35504 ENSMODP00000003676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]