SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003700 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003700
Domain Number 1 Region: 48-143
Classification Level Classification E-value
Superfamily Immunoglobulin 1.45e-19
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003700   Gene: ENSMODG00000003046   Transcript: ENSMODT00000003783
Sequence length 417
Comment pep:novel chromosome:BROADO5:5:101359135:101425564:1 gene:ENSMODG00000003046 transcript:ENSMODT00000003783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRLKSGVRVCFLPPVPFLISLLATLAAARNITNSTLNGTDVILGSMPAIIARVDHVIVR
EGKSALINCNVLGVPDPHFKWYNSNGRLLKEEEDQEGPGGGKWWMQDNGLLNITQVSFSD
RGKYTCVASNIYGTVNNTVTLRVIFTSGDMGIYYMIVCLVAFTIVMVLNITRLCMMSSHL
KKTEKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELAR
SVPLPPLIMNCRTIMEEIMEVVGLEEQGQNFVRHTPEGQEATDGDEVYTIPNALKRSDSP
TGDSDASSLHEQPQQIAIKVSVHPLSKKDRLEDQEGVQVEIKDEEVPEEAVAPEGPEPPS
ELPVDAETSGDSPPSSESAPPSEPVNPKGPPEPAHPKPTEPAVATETNTCIIYESHV
Download sequence
Identical sequences F6PP60
XP_001365482.1.35504 XP_007496186.1.35504 XP_016278610.1.35504 XP_016278611.1.35504 XP_016278612.1.35504 ENSMODP00000003700 13616.ENSMODP00000003700 ENSMODP00000003700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]