SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003757 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003757
Domain Number 1 Region: 10-106
Classification Level Classification E-value
Superfamily Immunoglobulin 8e-19
Family I set domains 0.0045
Further Details:      
 
Domain Number 2 Region: 108-207
Classification Level Classification E-value
Superfamily Immunoglobulin 4.09e-18
Family I set domains 0.0066
Further Details:      
 
Domain Number 3 Region: 212-280
Classification Level Classification E-value
Superfamily Immunoglobulin 2.27e-17
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003757   Gene: ENSMODG00000003085   Transcript: ENSMODT00000003841
Sequence length 280
Comment pep:novel chromosome:BROADO5:Un:62789502:62791597:1 gene:ENSMODG00000003085 transcript:ENSMODT00000003841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHWPPSLPGLPKPDIFAEPSSVVAPGTNVTLRCSALQSTSQELLFTLSKAGSPGYPHPDK
TGSEARFSLPSVKVRDAGSYSCFYSERRSAKGKSETSETLDLVVTGSLPQPSLQALPSAK
VSLNGTVTLRCVRPVKPSLGSVMFMWLKAGTPEPLGRALQQSQRWADFTLPSVRVQNAGS
FRCVYYEKTVQPRASEPSEPLHVCVTGLLPWWPSLTVEPSSSVSLGEKVTLWCQSASCGT
RFTLHKDGEDKPVQTIDSPQDKAGFLIPRVTREHAGTYYC
Download sequence
Identical sequences H9H619
ENSMODP00000003757 13616.ENSMODP00000003757 ENSMODP00000003757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]