SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003798 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003798
Domain Number 1 Region: 141-235,429-512
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000169
Family Fibronectin type III 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000003798
Domain Number - Region: 44-116
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0582
Family Fibronectin type III 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003798   Gene: ENSMODG00000003116   Transcript: ENSMODT00000003882
Sequence length 583
Comment pep:novel chromosome:BROADO5:3:450755444:450779144:-1 gene:ENSMODG00000003116 transcript:ENSMODT00000003882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TESPSCHPAPNDSTFVFSNTGEACKNGECCFQELPSWEGGSVVEAPRELRCYRIISSGYE
CSWQYDGDPTDVTHFLRFCLRNGNCCYFEAGKANRVSFTDQAKVPILQNVTFWVESRVGN
WTAMSPKITLVLCRAFKFDPPNEEMTVSKIHDQFMIKWKIPEKQEDAIAEYRYRTWNGTW
EQGDCGAQTNSDFETCSLQLEAPVAYEIQLRRHKKASPTGQWSEWSRSICIPAEIPELNY
TVGKLDNNGKRDLIFDWEQPRQSRQPQNCVEEVSFSLVLQMLSCPCKPKSKKKMSLEKVI
QISGAEYDVIIRTQGTLGPQLNRTFHIPADPNSDAGFLNISTSEDNMTMQWFSESGVKSY
CIEWYPHTANWTNAACVLKSSRKEKDDRKVIYSRDKALGIMDLLKCYQINIYASDQPRNP
QSWVTVFSVHHFSGDGKSTPISQMRNQALGSIFLEWNPSPISKCPGVLKNYVIQCWNEKN
NKTIFHHVDASASQYTIRNLSNGTSYIIQIRGDMATTSVLWRNSLSFKLDDEMPPSFPFF
LLALGIFAAIILTAVLVYYVLKRVKSYLCPPLPNPSISNATKF
Download sequence
Identical sequences F6S3E7
ENSMODP00000003798 13616.ENSMODP00000003798 ENSMODP00000003798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]