SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003822 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003822
Domain Number 1 Region: 9-133
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000664
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 
Domain Number 2 Region: 134-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000144
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003822   Gene: ENSMODG00000003137   Transcript: ENSMODT00000003907
Sequence length 285
Comment pep:novel chromosome:BROADO5:3:63906537:63920540:1 gene:ENSMODG00000003137 transcript:ENSMODT00000003907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APSHKWSMQVPSDVTGEAGGGVVLLCTFTHPHKYYDGMITVIWRIREPFNGSQVFRCVVH
SNSDHCQTTVSYKGKYKLLGNPRHNNISIRLDNLTWMDDNRYFCRVEFAGDIHDRYESRS
GIRLHVIAAPRIINITVLPGPDHIFSARCTAEGEPLPSLTWTGPSAGNSTSVYSQSHQIT
KELHALAQDGRYTCTATNSLGHAEGSVYFYKFRAAGDSSVLLTLLFALGIKLLLLLVILG
AFACQSKGGCFFKYFLVSRPQVQESSYENLNHSNNRAPPAAAAAQ
Download sequence
Identical sequences F6WUM5
ENSMODP00000003822 ENSMODP00000003822 13616.ENSMODP00000003822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]