SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003854 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003854
Domain Number 1 Region: 32-179
Classification Level Classification E-value
Superfamily C-type lectin-like 1.5e-28
Family C-type lectin domain 0.00000264
Further Details:      
 
Domain Number 2 Region: 503-576
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.25e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 319-386
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 4 Region: 374-439
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000113
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 5 Region: 560-626
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000126
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 6 Region: 256-328
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 442-514
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000528
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Domain Number 8 Region: 684-749
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000764
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 9 Region: 200-260
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000278
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 10 Region: 622-688
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000792
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003854   Gene: ENSMODG00000003164   Transcript: ENSMODT00000003940
Sequence length 817
Comment pep:novel chromosome:BROADO5:2:61819596:61870562:-1 gene:ENSMODG00000003164 transcript:ENSMODT00000003940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCYLEAYWHIRFQRTIFGTALISALISQVQVESWTYHYSDQKAYSWNASRKFCKTFYTD
LVAIQNQNEIAYLNNFLPYYPHYYWIGIRKINNIWTWVGTNRTLTKEAENWAENEPNNKR
NDQDCVEIYIKSPSSPGKWNDEPCMKRKRALCYQASCKPSSCNQHGECIETIGNYTCSCF
PGFYGQECEYVIQCKELDYFPSNMLMTCNHPLGKFSYQSKCNFYCMEGYRLKGADLLQCS
SSGEWTDEVPECSVIGCPALKSPERGKMICPYSSMENYRQSRCSFSCEEGFTLKGVEVIW
CTVFGVWTAPVPRCEAVQCPNLNAPDGGVMNCIHSHAPFAYESTCEFSCQPTYRMSGLET
LQCLASGQWTSPTPICHAITCDPLEVPAHVSFNCSSYPIQFQLNSECSFQCDKGFVLKGA
EITKCDLSGIWTESVPVCHAKQCQDLRAPIKGHLSCSHPFGDFMYQSSCTLTCDEGFVPS
ESEELHCLDTGEWSSLPLLCEAITCKPLLAPQQGTMTCDHPFENYSYESTCQFSCNEGFS
LVGPDKVKCTTSGHWTAHTPTCQAIKCPPLVAPHQGAFHCSGENGNMSYNSTCDFSCKSG
LMIIGSHILKCTASGSWTSLAPSCKAIRCPVLDDPKWGNMECSYNERDSRDSTICHFTCD
VGFVLKGSDSVQCSTYGNWTAPPPTCEVVKCPELILPKPMLMNCSHPWGNFSYESTCIFY
CPTDQMLNGSPEIKCQAEGKWSKKMPTCQGNPLSIQEALTYFGGAVASVTSLVIGGSILV
ILRKRFRQKEDGKRPLNPQSLMGTPGVFTNVAFDSIH
Download sequence
Identical sequences F6WDI7
XP_007480803.1.35504 ENSMODP00000003854 ENSMODP00000003854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]