SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003884 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003884
Domain Number 1 Region: 35-182
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-29
Family C-type lectin domain 0.00000791
Further Details:      
 
Domain Number 2 Region: 195-268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000108
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 252-317
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000598
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 4 Region: 314-379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000361
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003884   Gene: ENSMODG00000028669   Transcript: ENSMODT00000003970
Sequence length 433
Comment pep:novel chromosome:BROADO5:2:61942063:61974439:-1 gene:ENSMODG00000028669 transcript:ENSMODT00000003970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLFWKYLIPFEGWWGLFKLWFLIVLYCDFLALYGGDCWTYHYSEKPMNWTRARNYCQTH
YTDLVAIQNKGEIAYLNATLPLRRNYYWIGIRKIKGIWTWVGTNKPLTEEAENWGKGEPN
NKKSKEDCVEIYIKRKEDAGKWNDDSCLKLKVALCYEASCQPSLCSGHGECIETINNYTC
KCDLGYYGPNCENVIQCEPLRAPDSGMINCTHPLEDFSFSSKCTFSCSEGRHLIGAEDTT
CEVSGNWSSPEPMCQVTQCEPLMAPEHGMMECIHPLGKFSFTSKCTFSCLERMALTGVEE
VSCGASGAWSSPKPICQETHCEPLVTPELGIMNCTHPLGYFNVSSKCTFSCAEGISLLGA
METTCETSRNWSSPKPICEGTRNILSPIKEGNYNPIFIPLGIVVTAFCGLAFIIWLARRL
KRGKKSPNRSDMY
Download sequence
Identical sequences F6VGS6
ENSMODP00000003884 ENSMODP00000003884 XP_007480807.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]