SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003892 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000003892
Domain Number - Region: 99-258,316-408
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00174
Family Hermes transposase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003892   Gene: ENSMODG00000023553   Transcript: ENSMODT00000003978
Sequence length 409
Comment pep:novel chromosome:BROADO5:3:508702465:508703850:-1 gene:ENSMODG00000023553 transcript:ENSMODT00000003978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLECLLSVAKEMCPEKGRLFRTVSLSGSTITQRFEEMGDNLHQHLQNSTRKFSYFLAFDE
RNDVRDSAQLLIFIRGTNGNFEVTEELDALKSIKGTPRGEDIYEKVSQTVKDLELVWAIL
ASVTTDAAPSMVGSKKGVIAHINKEMDKCNHSHPMAIHCLIHKLCSKSLKWDSVMKIVVS
WRVLRRFYDLLPQIIAFMLSKNKEVSELNDAEWKWHLTSLTEVTELLSSFNVQLQGKGKL
ICDMQSHVKAFEVKLSLLIKTSEGGKFLPSLLNSKSVSGKTLDCIPKRNMTRLTGKFQFR
FKEFHLHEQDIQLFCNPFPIDIENVDTIYQKELAELLQNYAFKSRSLPNFYAPHPSETYP
NLRNHALKMATIFGSTYAREQTFSRMKLLKSPTRSRLTDALLHYLLWLE
Download sequence
Identical sequences F6VG11
13616.ENSMODP00000003892 ENSMODP00000003892 ENSMODP00000003892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]