SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003919 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003919
Domain Number 1 Region: 376-542
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.23e-28
Family Toll/Interleukin receptor TIR domain 0.00092
Further Details:      
 
Domain Number 2 Region: 19-117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000495
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 231-329
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000313
Family I set domains 0.021
Further Details:      
 
Domain Number 4 Region: 144-215
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000173
Family I set domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003919   Gene: ENSMODG00000003219   Transcript: ENSMODT00000004005
Sequence length 666
Comment pep:novel chromosome:BROADO5:X:20711069:21178277:1 gene:ENSMODG00000003219 transcript:ENSMODT00000004005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFTLLLFSVDGCIDWSVDLKTYMALAGEPVRVKCALFYSYIRTNYSTAQSMGLRLIWYK
NKGDLEEPIIFSEVRMSKEDDSIWFHSVEAQDSGFYTCVLRNSTYCMKVSMSLTVAENES
GLCYNSQIRYSEKSEVTKRKEIVCPDMEDYKTANKEPDVVWYKECKPKMWRSIIIQKGNA
LLIQEVHEEDGGNYTCELKYEGKLIRRTTELKVTALLTDKPPKPLFPRENQPSVIDVQLG
KPLNIPCKAFFGFSGESGPMIYWMKGEKFIEELAGHIREGEIRLLKEHLGEKEVELSLTF
DAVVEADLANYTCHVENRNGRKYASILLRKKDLIYKIELAGGLGAILLLLVLLIIIYKCY
NIELLLFYRQNFGNNEDADDNKEYDAYLSYTKVDPDALDCDNNEEEQFALEILPDVLEKH
YGYKLFIPDRDLIPSGTYIEDLTRCIEQSRRLIIVLTPDYVLRRGWSIFELETRLHSMLV
SGEIKVIWIECTELKEKVNCREVEVLKRNIKLLSLVKWKGTQSSKLNSKFWKHLVYEMPM
KKKVTLSRRQVLDSAEQGLFGELQTVPSIAVTSTSAALVSSQADLSDFHPTDSMPMRHCC
RSYNYEMPTSSLPLGTHHHTYCNIPLTLLNGQLPLNNASKNTPEFHRSSPLQPLSSKELS
FTSDIW
Download sequence
Identical sequences F6TZ42
ENSMODP00000003919 ENSMODP00000003919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]