SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003985 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003985
Domain Number 1 Region: 114-478
Classification Level Classification E-value
Superfamily L domain-like 1.9e-63
Family Internalin LRR domain 0.045
Further Details:      
 
Domain Number 2 Region: 685-780
Classification Level Classification E-value
Superfamily Immunoglobulin 1.7e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 598-696
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-23
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 493-604
Classification Level Classification E-value
Superfamily Immunoglobulin 1.45e-18
Family I set domains 0.02
Further Details:      
 
Domain Number 5 Region: 41-108
Classification Level Classification E-value
Superfamily L domain-like 0.000000000107
Family Ngr ectodomain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003985   Gene: ENSMODG00000003264   Transcript: ENSMODT00000004071
Sequence length 1095
Comment pep:novel chromosome:BROADO5:6:219314420:219454003:-1 gene:ENSMODG00000003264 transcript:ENSMODT00000004071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRSWGGPGAPRWPLPRLLLALGLRLLLLAAAPGPGAPCASNCTCTGALLDCSGLGLAA
LPRDIPSWTVTLNLSNNKLTEIDPAAFEDLVNLQEVHLNNNELTIIPALGAASSRILSLY
LQHNRIRNVEGSQLKPYVSLQMLDLSSNNITEVRSSCFPRGLHIKELYLGSNRISTLEPG
AFDSLSRSLLTLRLSKNRITQLPVKAFKLPRLTQLELNRNRIRLIEGLTFQGLDSLDVLK
LQRNNISKLTDGAFWGLSKMEVLHLEYNSLTEVNSGSLYGLTALHQLYLSNNSISRINRD
GWSFCQKLQELILSFNNLTRLDEESLADLSSLQILRLSHNSINHIAEGAFKGLKNLRVLD
LNHNEISGTIEDTNGAFTGLDSLNKLTLFGNKIKSVAKRAFSGLEGLEHLNLGENAIRSI
QFDAFAKMKNLQELHISSDSFLCDCQLKWVPQWLMGRGLQTTVVATCAHPESLKGQSIFS
VPPESFVCDDFPKPQIITQPETTMAVAGKDIRFTCSAASSSSSPMTFAWKKDNEVLPNAD
IENFAHVRAQAGELMEYTTILHLRQVTFHHEGRYQCVITNHFGSTYSHKARLTVNVLPSF
TKIPHDIAIRTGTTARLECAASGHPNPQIAWQKDGGTDFPAARERRMLVMPDDVVFFITD
VKIDDMGVYSCTAQNSAGSVSANATLTVLETPSLVTPLEDRVAAVGETVALQCKASGSPQ
PRITWLKGDHPVSVSDRHHFTPGNQLLIIQSVVPEDADRYTCEMSNALGTERAHSQLSVL
PTPGCRKDGTTVGIFTIAVVCSIVLTSLVWVCIIYQTRKKSEEYSVTNTDETIVPPDVPS
YLSSQGTLSDRQEGVVRTEGGHQANGHLESNGVCQRDPGLNPDVDIHGPAYRQPKLCIGH
NKEVWKVADGAFSLDKTDYGMPATGSDFSDNATHYSKDKDSYPLHKTHPSTRGSQEPSQS
EQECPLLQSDGSLAGPHPQGNGNSLYPSNHDRMLAPALQKPLPLDHKGGSLNDLGKSSES
ESVVLHPLSLGTRGVALTAASAPSSGFPELNEAQADPSLPNGHLPKPCDSSHESTALRGS
FHVQRNVPLLFVPNI
Download sequence
Identical sequences F6T013
XP_007500110.1.35504 ENSMODP00000003985 ENSMODP00000003985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]