SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004043 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004043
Domain Number 1 Region: 578-882
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-79
Family Protein kinases, catalytic subunit 0.000000000314
Further Details:      
 
Domain Number 2 Region: 17-187
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-66
Family Ephrin receptor ligand binding domain 0.000012
Further Details:      
 
Domain Number 3 Region: 876-943
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.72e-18
Family SAM (sterile alpha motif) domain 0.0011
Further Details:      
 
Domain Number 4 Region: 380-473
Classification Level Classification E-value
Superfamily Fibronectin type III 5.57e-18
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 235-313
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000581
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004043   Gene: ENSMODG00000003309   Transcript: ENSMODT00000004129
Sequence length 948
Comment pep:novel chromosome:BROADO5:4:375228993:375262476:1 gene:ENSMODG00000003309 transcript:ENSMODT00000004129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPELTLLSSLPSLPVVLLDFAAAKGELGWLTYPYNNGWDVMQNIMDDQPIYMYSVCNV
ESGEQDNWLRTNWIYRSEAEKVFIELKFTVRDCNSFPGRATSCKETFNLYYAESDVDYGT
NFQKRQFKKIDTIAPDEITVSSDFETRNVKLNVEERAVGPLTQNGFYLAFQDIGACVALL
SVRIYYKKCPEMLQSLARFPETIAGSDSANLAKVAGTCVEHALVAPGGEEPTMHCNVDGE
WLVPIGQCMCEAGYEKVEESCQACSPGSFKSDASDRSCTQCPLHTLPSPEGATICECEEG
YFRAAEDPASMPCTRKLPALLGVEELRGKWERCFKDILLAPRRVGHRGYQVTVGELKSLN
GSFGHLGSLGWSCSPYLYHPNEPPKVKLDSRSTTSLSVSWTIPLRQQSRVWKYEVTYHKK
KDTNSYNVRRTEDFSMTLDDLMPGTTYLVQVQALTQEGQGAGSRVHEFQTLCELEALNDD
CGRRSLDISLEAPLRMLLPFSLWIILFHPCPIATESSSNAAVIGGILDLVCLPPALLDLP
SIMSSTPFLSSSEQLKPLKTYVDPHTYEDPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEV
FKGSLKASGKKEVPVAIKTLKAGYTEKQRVDFLSEASIMGQFSHHNIIHLEGVVSKYKPM
MIITEYMENGALDKFLREKDGEFCVIQLVGMLRGIASGMKYLASMNYVHRDLAARNILVN
SQLVCKVSDFGLSRVLEDDPEATYTTSGGKIPIRWTAPEAISYRKFTSASDVWSYGIVMW
EVMSYGERPYWELSNHEVMKAINEGFRLPAPMDCPSAIYQLMMQCWLQERTRRPKFPDIV
SILDKLIRAPESLKTLADFDPRVSIRLPSTSGSEGIPFRTVSEWLESIKMHQYTEHFMSS
GYNAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKEQVNTVGIPI
Download sequence
Identical sequences F6V9S3
ENSMODP00000004043 ENSMODP00000031819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]