SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004053 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004053
Domain Number 1 Region: 328-428
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000417
Family Spectrin repeat 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004053   Gene: ENSMODG00000003315   Transcript: ENSMODT00000004139
Sequence length 457
Comment pep:novel chromosome:BROADO5:1:626811292:626823251:-1 gene:ENSMODG00000003315 transcript:ENSMODT00000004139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLASCSDEAGRNRPRPSFQAEYWACVLPDSLPPSPNRQSPLWNPNKDYEDLLDYTYPLKP
KAQLPKRLSNRMLADPFLHDSGIDLDSFSMSPENTLKSPGTLSHDCLPVEADGQLPLEPR
NGDATASLPPETFGSVASALFTSTPKARSRLAPGNDTTPTSPEPNRPSQGAQSPRNALSA
LVEKKGCRDDPQRLFQETPLESDWETHEIEIEDEYLALPPRLTQVSSLAPYLSTVQASDS
QPPEGRRFPASSGGGEPTPSLSRSRHCCPRSPPPQVQELDREGEPGAPGSRTRTMVSFQE
RLAGLPSWDLKPEGLCLGKEKDQGTDSLLQCVKMFCCHLEELIGWLYKVAEVTDNLIPPK
SNLASLKSSLQLYRQFKKDIAEHQSLTQNVLQKGEILLQCLLDNAPVLKDVLGLLARQSS
ELEEHAERLYDSVLAAVDTLAGNPAMPDAKSAPWERI
Download sequence
Identical sequences F7DYJ9
13616.ENSMODP00000004053 ENSMODP00000004053 ENSMODP00000004053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]