SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004279 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004279
Domain Number 1 Region: 236-318
Classification Level Classification E-value
Superfamily Immunoglobulin 1.26e-18
Family I set domains 0.065
Further Details:      
 
Domain Number 2 Region: 405-506
Classification Level Classification E-value
Superfamily Immunoglobulin 3.18e-17
Family C2 set domains 0.0004
Further Details:      
 
Domain Number 3 Region: 115-215
Classification Level Classification E-value
Superfamily Immunoglobulin 6.95e-17
Family C2 set domains 0.00041
Further Details:      
 
Domain Number 4 Region: 527-637
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000926
Family I set domains 0.043
Further Details:      
 
Domain Number 5 Region: 598-696
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000173
Family I set domains 0.023
Further Details:      
 
Domain Number 6 Region: 320-412
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000167
Family I set domains 0.0000795
Further Details:      
 
Domain Number 7 Region: 36-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000224
Family I set domains 0.0000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004279   Gene: ENSMODG00000003497   Transcript: ENSMODT00000004369
Sequence length 743
Comment pep:novel chromosome:BROADO5:2:467517196:467542137:1 gene:ENSMODG00000003497 transcript:ENSMODT00000004369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKMSGQKLMIVLAANLLWMIFAASEDLNIEVGPSSRIAAQIGGYTELTCTMTGCESPFF
SWRTQIDSPLGGKVQNEGTKSTLIMNPVSFQNEHAYLCTASCGSKKVERGIQVELYSFPS
DPEIEMSGPLIVGSPITVTCKVPKVYPSERLEMAFLMEGSYHPMEVHEIVEDAEESILVT
KGLKMTFTPTMEDMGKSLTCEAKLPIDEMDFEPKERRTTQKLQVNDVPKNTAISISPSNI
VQEGDPVTLTCSSEGLPPPRIFWNKKQDNEDPLPLSENATLTLVATRREDSGTYVCEAKN
QFGKSRKEVEIIVQGKPLRVEVSPGPKTAAQIGDSVVLTCTMMGCEAPFFSWRTQIDSPL
GGKVSNEGTKSTLIMNPIGFENEHSYLCTASCGDRKVEKGIQVELYSFPSDPEIEMSGPL
IVGSPITVTCKVPKVYPSERLEMAFLMEGSHLPMERQEIVEDAEESILVTKGLKMSFTPT
MEDMGKSLTCEAKLPIDEMEFEPKERRTTQILQVKMRPKDTSLTAFPSDSVKEGDSVTIS
CTSGDVPKSQIILRKKTEWGETELEFTAGTYIIPAAQLEDAGMYECESKNEGGSEVRSLM
LDVKVPPRNTTIFIHPSRTVLEGENVTITCKTFSHPPAVIVLKKVDVDNEVTMCSKNGTF
TLYHVTPDDTGVYVIDISNEVGNDSGQIEISVIEMPKYFSPQLVALYCLSSLIIPATGMV
IYFARKANHKGSYSLVDALKSKV
Download sequence
Identical sequences F7CRW5
ENSMODP00000004279 XP_007485096.1.35504 ENSMODP00000004279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]