SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004289 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004289
Domain Number 1 Region: 132-233
Classification Level Classification E-value
Superfamily Fibronectin type III 1.43e-27
Family Fibronectin type III 0.00039
Further Details:      
 
Domain Number 2 Region: 40-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000274
Family I set domains 0.062
Further Details:      
 
Domain Number 3 Region: 236-317
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000144
Family Fibronectin type III 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004289   Gene: ENSMODG00000003510   Transcript: ENSMODT00000004380
Sequence length 421
Comment pep:novel chromosome:BROADO5:3:451770948:451782410:-1 gene:ENSMODG00000003510 transcript:ENSMODT00000004380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPTASRSSARRCPKNAKTVEVPLCCCVMGILPSGGGDDLAVIAPQDPTLLIGSSLHATCS
VSVSGSDAPTAEGLYWTLNGRRLAPELSQVLNATTLGLALANLNGSKQQSGDNLVCHAQD
GSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWFPGTQGETFLHTNYTLKYKLRWYGQ
DNTCQEYHTVGPYSCHIPKDLALFTPYEIWVEATNRLGSARSEVVTLDILDVVTTDPPPD
VHVSRVGGLEDQLSVHWNSPPALKDFLFQAKYQIRYRVEDSVEWKASASLGLPTAGNAST
CQQVPPVIYDVRLMSLSVRAVPGLSSHHSNPYLRASLHSPERQGSGGACEPRGGEPSSMP
VRRELKQFLGWLKKHSYCPNLSFRLYDQWRAWMQKSHKTRNQDEGLLSPGRRNTARGNWA
G
Download sequence
Identical sequences F7C8F9
13616.ENSMODP00000004289 ENSMODP00000004289 ENSMODP00000004289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]