SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004432 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004432
Domain Number 1 Region: 442-702
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-49
Family YWTD domain 0.0000000981
Further Details:      
 
Domain Number 2 Region: 233-272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000301
Family LDL receptor-like module 0.00052
Further Details:      
 
Domain Number 3 Region: 30-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000746
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 4 Region: 147-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000114
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 5 Region: 271-311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00048
Further Details:      
 
Domain Number 6 Region: 69-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 7 Region: 186-224
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000107
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 8 Region: 352-435,706-750
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000267
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 9 Region: 106-148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000785
Family LDL receptor-like module 0.00018
Further Details:      
 
Domain Number 10 Region: 317-351
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000511
Family LDL receptor-like module 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004432   Gene: ENSMODG00000003620   Transcript: ENSMODT00000004528
Sequence length 846
Comment pep:novel chromosome:BROADO5:6:101931973:101972078:1 gene:ENSMODG00000003620 transcript:ENSMODT00000004528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSSLWGLWLLVAMWCLSGELSTVEGTRTKCESSQFQCSNGRCITLLWKCDGDEDCSDG
SDESSCVKKTCAESDFVCNNGQCVPNRWQCDGDPDCEDGSDERPEQCNMRTCRINEISCG
VRSTQCIPVSWKCDGENDCDSGEDEENCGNVTCSPEEFTCSSGRCISKNFVCNGQDDCSD
GSDELDCAPPTCGTHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVPHEKCPA
SEIQCGSGECIHMKWRCDGDPDCKDGSDEINCPSRTCRPDQFECEDGNCIHGSRQCNGVR
DCIDGTDEINCKNANQCSGPGKFKCRSGECIDISKVCNQQQDCKDWSDEPLKDCNVNECL
VNNGGCSHICKDLIIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCEC
SRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTIALDADIAAQ
KLFWADLSQKAIFSAPIDARDKVGRHVKMIDNVYNPAAIAVDWVYKNIYWTDVASKTISV
ATLDGTKRKILFNSDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTIDI
QWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLAVTIFEDRVYW
IDGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPAGKNWCEEDTENGGCDYLC
LPAPQINDHSPKYACSCPNGYNLEGDGRACRRINVTTAISGVNVSLGGTSAAWAILPVLL
LAMAAAAGYFMWRNWQHKNMKSMNFDNPVYLKTTEEDLTIDIGRHSTSVGHTYPAISVVS
TDDDLA
Download sequence
Identical sequences F7BMW3
ENSMODP00000004432 XP_007498654.1.35504 XP_007498656.1.35504 ENSMODP00000004432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]