SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004590 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004590
Domain Number 1 Region: 21-147
Classification Level Classification E-value
Superfamily Immunoglobulin 2.69e-27
Family V set domains (antibody variable domain-like) 0.00086
Further Details:      
 
Domain Number 2 Region: 102-216
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000143
Family C1 set domains (antibody constant domain-like) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004590   Gene: ENSMODG00000003750   Transcript: ENSMODT00000004690
Sequence length 287
Comment pep:known chromosome:BROADO5:3:432739073:432743503:1 gene:ENSMODG00000003750 transcript:ENSMODT00000004690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQWGNFGPGTKLTVLPLEKTLLTESGGGTYQAGKTLSLKCQTSGFQFKTSQLDWYLWTPG
HAPLWLTGLNSSSTDATEGRITSSREDNKNQIFLQIEDLGLRDSGQYHCARRVGNGDDTD
KLVFGLGTRVIVEPRPQAPLSPSVFLVRDQNAVACLIRNFYPKELHVSLTSSGTLISAQN
LTLAPMATGTYSAIHIGRVGENDAITCSVKHLEKEIHIVVFEDTFLVSDHTGPDPGIASE
LKLSCPEQDITRPEQGNKLLLSMLGLRLLFMKTVAINVIFTTMTLIF
Download sequence
Identical sequences F7DV39
ENSMODP00000004590 ENSMODP00000004590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]