SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004595 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004595
Domain Number 1 Region: 19-116
Classification Level Classification E-value
Superfamily Immunoglobulin 4.63e-29
Family V set domains (antibody variable domain-like) 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004595   Gene: ENSMODG00000003758   Transcript: ENSMODT00000004695
Sequence length 117
Comment pep:novel chromosome:BROADO5:3:432834857:432835207:1 gene:ENSMODG00000003758 transcript:ENSMODT00000004695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCVGLNLLGVFSTGSWAQVKLLESGGKVTHEGQSVTLTCKASGFNFKDYAMSWHWNPSG
SNRQFVASISPKTGSKREYKPSIQGRALITRNNEANTVSLTLRQLRKEDSGIYYCAK
Download sequence
Identical sequences F7DV10
ENSMODP00000004595 ENSMODP00000004595 13616.ENSMODP00000004595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]