SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004639 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004639
Domain Number 1 Region: 143-240
Classification Level Classification E-value
Superfamily Immunoglobulin 4.6e-17
Family I set domains 0.0073
Further Details:      
 
Domain Number 2 Region: 28-151
Classification Level Classification E-value
Superfamily Immunoglobulin 1.27e-16
Family V set domains (antibody variable domain-like) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004639   Gene: ENSMODG00000003791   Transcript: ENSMODT00000004739
Sequence length 329
Comment pep:novel chromosome:BROADO5:4:271830394:271838367:-1 gene:ENSMODG00000003791 transcript:ENSMODT00000004739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWLPGSLVFWTMLTLIYLIAPGCLVEVKVPIEPLSKPAGEAVELTCSYYTSVGENFALK
WSFVQPGNPISSDETILYFTNKELYLTGPQAKRVTLLQNPPTEGIATLRLTDIQPSDTGT
YLCQVNNPPDFHSNGLGLVNLTVLVPPTKPTCGQSGQISVGGGAALSCSSSGGAPRPVYT
WVRLGSAPTPAPGSMVQDEISGRLILTNLSLSSSGVYRCVAANQLGSAFCELTLAVADPS
KGRVAGAVIGVLLGLLFLVVGVFCLLKFQKERSKKSKEMYGGNDLREDAKAPGVYDSPLQ
RGHSDVGLLERSPSASTVTTTKSKLPMVV
Download sequence
Identical sequences F7AA21
ENSMODP00000004639 ENSMODP00000004639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]