SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004652 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004652
Domain Number 1 Region: 164-240
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000942
Family I set domains 0.022
Further Details:      
 
Domain Number 2 Region: 38-155
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000126
Family V set domains (antibody variable domain-like) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004652   Gene: ENSMODG00000003800   Transcript: ENSMODT00000004752
Sequence length 389
Comment pep:novel chromosome:BROADO5:4:271841242:271845956:-1 gene:ENSMODG00000003800 transcript:ENSMODT00000004752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCQPSPVWERSLGRVLHLIIKSLVTVSRAQLVVHEGSLRVEAVEGEEVVLPAWYSQNGMK
PSLKPDPPPYVLWFLEQSGKEMEQVLSYLNGVLLSKPRISLVNSMPSGNVSLRIVQLQEQ
DSGLYRCSVNVQDQGKSMSDVGSLELDVLVSPATPSCHLHGVPRMGTNVTLSCLTSRSKP
AAQYSWERLPPRAQFFFSPAVDSIRGSLFLTNLSASMSGVYVCKASNKVGSAQCNVTLEV
TSGPKAAVVAGAVVVTLVVLVLLVVLVLLYCHREKMQEEPANDIKEDAVAPRTLPWPKGS
DTISKNGTLSSVTSARALRPPHGPPRSGALTPTPSLSSQALSSPGLPRTNRTQPPTASPA
LGGVSSSALSRMGAVPVMVPAQSQAGSLV
Download sequence
Identical sequences F6ZK32
ENSMODP00000004652 ENSMODP00000004652 13616.ENSMODP00000004652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]