SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004674 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004674
Domain Number 1 Region: 118-209
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-25
Family I set domains 0.00058
Further Details:      
 
Domain Number 2 Region: 26-116
Classification Level Classification E-value
Superfamily Immunoglobulin 5.97e-18
Family I set domains 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004674   Gene: ENSMODG00000003816   Transcript: ENSMODT00000004774
Sequence length 294
Comment pep:novel chromosome:BROADO5:4:406082329:406085890:-1 gene:ENSMODG00000003816 transcript:ENSMODT00000004774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPLAIIFLSFGLWLHQWIGAQEATLPRPSLWADPGPLIPQKRSVILRCRGFPGAEKYRL
RREGGSPDRDVSTAGTEAEFPISSVTSDTVGHYRCLYMSQSHWSKPSEPVELVMTDWYDK
PSLSALPSPEVASGENVTLRCRSNQWFEKYALHKEGGAISQSQGSWYHADFLIPAVEVAH
QGSYRCYSLHRESPYEWSAPSDPLELRVTEATDDPQLQNSRNPWNSSNSTSDVPPQDYQV
GNLIRFSLAGLVLIMLGLLLAEAWHSERRHREAAQKPLPPLPVQPKKQGGSVNL
Download sequence
Identical sequences F6YW66
ENSMODP00000004674 XP_007492540.1.35504 ENSMODP00000004674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]